PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5AS_385093B54.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 827aa    MW: 94752.4 Da    PI: 4.7787
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5AS_385093B54.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR178.61.1e-24105192291
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                             Y+eY++++GFsvrk k+++ + ++ i +++++Cskeg +++e+ +  +++ +++etrt+Cka+++ + +++g+w+v+++  eHnHel
  Traes_5AS_385093B54.2 105 LYCEYGHRMGFSVRKGKQYYFTGTKVIRTKDYYCSKEGLKDDEQLT--EANFNKPETRTNCKAMVRFRVDSEGQWRVIQIIPEHNHEL 190
                            7*****************************************9988..9999************************************ PP

                   FAR1  90 ap 91 
                            +p
  Traes_5AS_385093B54.2 191 VP 192
                            86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.1E-22105192IPR004330FAR1 DNA binding domain
PfamPF105514.2E-30303397IPR018289MULE transposase domain
PROSITE profilePS509669.656584620IPR007527Zinc finger, SWIM-type
PfamPF044341.2E-5586613IPR007527Zinc finger, SWIM-type
SMARTSM005751.7E-7595622IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 827 aa     Download sequence    Send to blast
MFPFVVDDAE MEGTSVPIEI DGDAICLENV GDDEHEAQES EQVQIIYATE NGAQVAFDSQ  60
EQGTEEHSVR SEEEQENNSV IPSREEFTEE LRTKVAYSEE QAYRLYCEYG HRMGFSVRKG  120
KQYYFTGTKV IRTKDYYCSK EGLKDDEQLT EANFNKPETR TNCKAMVRFR VDSEGQWRVI  180
QIIPEHNHEL VPPEEIHLLR SVRILSIPKP GTLNAMVNAE IQSMHDSLHV HDDGAECHSQ  240
VSIQSYALLE PEDAEALVGY LKRRTIEQGM FYWDVQVDQE GQMTNFFWRD GRSRVDYDCF  300
GDVVVFDTSY RTNKYNMICA PFVGINHHMQ NVMFGCAFML DESLTSYEWL LKSFLESMGG  360
CPPKTIFTDQ NDTISKAIEV ILPETCHCLC QWHIEKNLQA HLDTPNASGT FHSMFMKCMK  420
DCESETEFEE TWAMMLQEHN LQDDQWLTDL FEQRHKWCTA LHKVAFDCGI RSLDRNFSSD  480
NVLGSIADES TSPTNFALEF DKLVGSWRTN ESVDDIQCKQ ISPECSVKQN SILQHAAEVY  540
THKVYKSLET EFLDGCSGTS YQEMQCSETL YRFEFIMQSS PKVWVVFLDT STMELSCSCK  600
KFEMMGILCS HALNALGLKN LDKIPESYVL KRWTKYVRKG TYVFPSDQSP EQDCTEAVLA  660
YRNRAMWFVY DLLMKSKGHQ DTRKLILDVL ENGEKSLESV CELKRMHIHP SGKDKDASKA  720
EKRKKKLKKQ DKNSRNVKQV VLPPPAESVF VDQPNQNQYF ATEDIATNSS IGRPFFYQEY  780
PATGVSASQI EGHANIHSVP QCAPAPQEFP AYDAVHPPST FGGESNF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3584850.0AK358485.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1077H06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578884.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLW5F4980.0W5F498_WHEAT; Uncharacterized protein
STRINGMLOC_62808.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.15e-80FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]